General Information

  • ID:  hor002353
  • Uniprot ID:  P06308
  • Protein name:  Ovulation hormone
  • Gene name:  NA
  • Organism:  Lymnaea stagnalis (Great pond snail) (Helix stagnalis)
  • Family:  Molluscan ELH family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Lymnaea (genus), Lymnaeidae (family), Lymnaeoidea (superfamily), Hygrophila, Panpulmonata, Euthyneura, Heterobranchia (subclass), Gastropoda (class), Mollusca (phylum), Lophotrochozoa, Spiralia, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  LSITNDLRAIADSYLYDQHKLRERQEENLRRRFLEL
  • Length:  36(198-233)
  • Propeptide:  MKMSGLLSKPDYGVVGIVFTVVFCCWCSSSTTHALSIAEPGRDRYDKRSPTGHGVEVVESGEDYGSNRPQPVYGDEDEEDSADVYVGSDESSSGEKTRLTAAKRRLRFNKRRLRASKRRLRFHKRRVDSADESNDDGFDRKAREPRLRFHDVRKRSATAEEGSENAEIEESHLGNSRSRRSAGSAPSSANEVQRSKRLSITNDLRAIADSYLYDQHKLRERQEENLRRRFLELGKRGSAFFDHIPIIFGEPQYDY
  • Signal peptide:  MKMSGLLSKPDYGVVGIVFTVVFCCWCSSSTTHA
  • Modification:  T36 Leucine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Induces ovulation and egg-mass production; it may also stimulate synthesis of secretory products in the female accessory sex glands and affect neurons in the neuronal circuits controlling locomotion and feeding.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P06308-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002353_AF2.pdbhor002353_ESM.pdb

Physical Information

Mass: 510051 Formula: C195H317N61O60
Absent amino acids: CGMPVW Common amino acids: L
pI: 7.54 Basic residues: 8
Polar residues: 7 Hydrophobic residues: 12
Hydrophobicity: -98.61 Boman Index: -13626
Half-Life / Aliphatic Index: 5.5 hour Aliphatic Index: 103.06
Instability Index: 8696.39 Extinction Coefficient cystines: 2980
Absorbance 280nm: 85.14

Literature

  • PubMed ID:  16578788
  • Title:  Purification and Amino Acid Sequence of the Ovulation Neurohormone of Lymnaea Stagnalis